PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.9126s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 398aa    MW: 44656.8 Da    PI: 7.7586
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.9126s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.13.5e-37130189261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k+l+cprC+s++tkfCyynny+++qPr+fC++C+ryWt+GG++r vPvG+grrknk +
  Araha.9126s0008.1.p 130 PDKILPCPRCNSADTKFCYYNNYNVNQPRHFCRKCQRYWTAGGSMRTVPVGSGRRKNKGW 189
                          7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-32127187IPR003851Zinc finger, Dof-type
PfamPF027011.1E-30132187IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.155134188IPR003851Zinc finger, Dof-type
PROSITE patternPS013610136172IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MWLSHLFMSL SQLTCNFSIF SVFMACGSIG MPQVRDTPVK LFGWTITPVS HDPHSSSSPV  60
LPDSSSSSSS SSPSLRPHMM NNQSAIDNTS LKMSSNLNNE SKETSENSDD QHSEITTITS  120
EEKTTELKKP DKILPCPRCN SADTKFCYYN NYNVNQPRHF CRKCQRYWTA GGSMRTVPVG  180
SGRRKNKGWV SSDQYLHITS EDTENYNSSS TKILSFESSD SLLTENTKHQ SSNVKINADS  240
VSQELNNFQG FLPPQASPVS PPWPYQYPPN PSFYHMPVYW GCAIPVWSTL GTSTCLGKRT  300
RDEAEASHES VKESKNAFVR TSLVLESQSI KNETIMTTNN HVWYPVPMTR EKTEQFSFFS  360
NGAETKSNNQ RFVPETYLKL QANPAAMARS MNFRESV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0065350.0AC006535.7 Genomic sequence for Arabidopsis thaliana BAC T24P13 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002890642.10.0Dof-type zinc finger domain-containing protein
SwissprotQ9LQX40.0DOF13_ARATH; Dof zinc finger protein DOF1.3
TrEMBLD7KQL60.0D7KQL6_ARALL; Dof-type zinc finger domain-containing protein
STRINGfgenesh1_pm.C_scaffold_10020910.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140821624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26790.10.0Dof family protein